Qiagen
Home  >  Products  >  Anti-ZNF7 (full length) polyclonal antibody

Anti-ZNF7 (full length) polyclonal antibody

Cat no: DPABH-09689


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09689
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 7553
Form: Liquid
Antigen: Recombinant full length protein corresponding to Human ZNF7 aa 1-686.Sequence: MEVVTFGDVAVHFSREEWQCLDPGQRALYREVMLENHSSVAGLAGFLVFK PELISRLEQGEEPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDIL KSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQN NCLNEETVVPKTFTKDAPQGCKE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7553
Alternative names: ZNF7; zinc finger protein 7; zinc finger protein 7 (KOX 4, clone HF.16); HF.16; KOX4; zinc finger protein KOX4; zinc finger protein HF.16; zinc finger protein zfp30; Zinc finger protein-7 (KOX4); C2-H2 type zinc finger protein; zf30; FLJ38706;
Additional info: May be involved in transcriptional regulation.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave