Qiagen
Home  >  Products  >  Anti-UBE2G1 (full length) polyclonal antibody

Anti-UBE2G1 (full length) polyclonal antibody

Cat no: DPABH-09561


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09561
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 7326
Form: Liquid
Antigen: Recombinant full length protein corresponding to Human Ube2G1 aa 1-170. NCBI: NP_003333.1Sequence: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY EGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGED KYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRN GEF
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7326
Alternative names: UBE2G1; ubiquitin-conjugating enzyme E2G 1; UBE2G, ubiquitin conjugating enzyme E2G 1 (homologous to C. elegans UBC7); ubiquitin conjugating enzyme E2G 1 (UBC7 homolog, C. elegans); ubiquitin conjugating enzyme E2G 1 (UBC7 homolog, yeast); ubiquitin-conjugating enzyme E2 G1; UBC7; ubiquitin-protein ligase G1; ubiquitin carrier protein G1; ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast); ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans); ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7); E217K; UBE2G;
Additional info: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-48-, as well as Lys-63-linked polyubiquitination. May be involved in degradation of muscle-specific proteins. Mediates polyubiquitination of CYP3A4.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave