Qiagen
Home  >  Products  >  Anti-TRIM32 (full length) polyclonal antibody

Anti-TRIM32 (full length) polyclonal antibody

Cat no: DPABH-09828


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09828
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 22954
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human TRIM32 aa 1-653.Sequence: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK LLASSINGVRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMC RSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFG EKLTRLRELMGELQRRKAALEGVSKDLQARYKA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 22954
Alternative names: TRIM32; tripartite motif containing 32; LGMD2H, limb girdle muscular dystrophy 2H (autosomal recessive); tripartite motif containing 32; E3 ubiquitin-protein ligase TRIM32; BBS11; HT2A; TATIP; zinc finger protein HT2A; zinc-finger protein HT2A; 72 kDa Tat-interacting protein; TAT-interactive protein, 72-KD; tripartite motif-containing 32; tripartite motif-containing protein 32; LGMD2H;
Additional info: Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) and promotes its degradation. May play a significant role in mediating the biological activity of the HIV-1 Tat protein in vivo. Binds specifically to the activation domain of HIV-1 Tat and can also interact with the HIV-2 and EIAV Tat proteins in vivo.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave