Qiagen
Home  >  Products  >  Anti-TRAF2 (full length) polyclonal antibody

Anti-TRAF2 (full length) polyclonal antibody

Cat no: DPABH-09673


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09673
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 7186
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human TRAF2 aa 1-501. (NP_066961.2).Sequence: MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCG HRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREV ESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKER HLEHECP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7186
Alternative names: TRAF2; TNF receptor-associated factor 2; TRAP3; E3 ubiquitin-protein ligase TRAF2; tumor necrosis factor type 2 receptor associated protein 3; tumor necrosis factor type 2 receptor-associated protein 3; TRAP; MGC:45012;
Additional info: Regulates activation of NF-kappa-B and JNK and plays a central role in the regulation of cell survival and apoptosis. Required for normal antibody isotype switching from IgM to IgG. Has E3 ubiquitin-protein ligase activity and promotes Lys-63-linked ubiquitination of target proteins, such as BIRC3, RIPK1 and TICAM1. Is an essential constituent of several E3 ubiquitin-protein ligase complexes, where it promotes the ubiquitination of target proteins by bringing them into contact with other E3 ubiquitin ligases. Regulates BIRC2 and BIRC3 protein levels by inhibiting their autoubiquitination and subsequent degradation; this does not depend on the TRAF2 RING-type zinc finger domain.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave