Qiagen
Home  >  Products  >  Anti-TNFRSF18 (full length) polyclonal antibody

Anti-TNFRSF18 (full length) polyclonal antibody

Cat no: DPABH-09737


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09737
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 8784
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 99% PBS
Antigen: Full length protein corresponding to Human TNFRSF18 aa 1-241.Sequence: MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCC RVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGV QSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHN AVCVPGSPPAEPLGWLTVVLLAVAACVLLLT
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8784
Alternative names: TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; AITR; CD357; GITR; activation-inducible TNFR family receptor; glucocorticoid-induced TNFR-related protein; TNF receptor superfamily activation-inducible protein; GITR-D;
Additional info: Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave