Qiagen
Home  >  Products  >  Anti-SSX2 (full length) polyclonal antibody

Anti-SSX2 (full length) polyclonal antibody

Cat no: DPABH-09652


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09652
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 6757
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 99% PBS
Antigen: Full length protein corresponding to Human SSX2 aa 1-223. Isoform 2 (Q16385-2)Sequence: MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVY MKRKYEAMTKLGFKATLPPFMCNKRAEDFQGNDLDNDPNRGNQVERPQMT FGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEK IHERSGNREAQEKE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6757
Alternative names: SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40;
Additional info: Could act as a modulator of transcription.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave