Qiagen
Home  >  Products  >  Anti-RPS27A (full length) polyclonal antibody

Anti-RPS27A (full length) polyclonal antibody

Cat no: DPABH-09734


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09734
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 6233
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 99% PBS
Antigen: Full length protein corresponding to Human RPS27A aa 1-156.Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKL AVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCF NKPEDK Database link: NP_002945.1
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6233
Alternative names: RPS27A; ribosomal protein S27a; ubiquitin-40S ribosomal protein S27a; S27A; Uba80; UBCEP80; ubiquitin carboxyl extension protein 80; ubiquitin C; ubiquitin-CEP80; 40S ribosomal protein S27a; ubiquitin and ribosomal protein S27a; UBC; CEP80; UBA80; UBCEP1;
Additional info: RPS27A (Ribosomal protein S27a) is a component of the 40S subunit of the ribosome. It is synthesized as a C-terminal extension protein (CEP) of ubiquitin. The fusion protein consists of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. The protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave