Qiagen
Home  >  Products  >  Anti-RGS2 (full length) polyclonal antibody

Anti-RGS2 (full length) polyclonal antibody

Cat no: DPABH-09698


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09698
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5997
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human RGS2 aa 1-211. (NP_002914.1)Sequence: MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQ NSSTPGKPKTGKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAF LKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINI DFQTKTLIAQNIQEATSGCFT
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5997
Alternative names: RGS2; regulator of G-protein signaling 2, 24kDa; G0S8, regulator of G protein signalling 2, 24kD; regulator of G protein signalling 2, 24kDa; regulator of G-protein signaling 2; G0/G1 switch regulatory protein 8; cell growth-inhibiting protein 31; G0 to G1 switch regulatory 8, 24kD; cell growth-inhibiting gene 31 protein; G0S8;
Additional info: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. May play a role in leukemogenesis. Plays a role in negative feedback control pathway for adenylyl cyclase signaling. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave