Qiagen
Home  >  Products  >  Anti-PRPH2 (full length) polyclonal antibody

Anti-PRPH2 (full length) polyclonal antibody

Cat no: DPABH-09704


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09704
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5961
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PRPH2 aa 1-346.Sequence: MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSD VMNNSESHFVPNSLIGMGVLSCVFNSLAGKICYDALDPAKYARWKPWLKP YLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKYYRDTDTPGRC FMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRY
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5961
Alternative names: PRPH2; peripherin 2 (retinal degeneration, slow); RDS, retinal degeneration, slow; retinal degeneration, slow (retinitis pigmentosa 7); RP7; peripherin-2; CACD2; rd2; retinal peripherin; TSPAN22; tspan-22; tetraspanin-22; peripherin 2, homolog of mouse; peripherin, photoreceptor type; retinal degeneration slow protein; DS; RDS; RP7; AVMD; PRPH; AOFMD;
Additional info: May function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. It is essential for disk morphogenesis.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave