Qiagen
Home  >  Products  >  Anti-PRKCSH (full length) polyclonal antibody

Anti-PRKCSH (full length) polyclonal antibody

Cat no: DPABH-09587


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09587
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 5589
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein within Human PRKCSH aa 1-398. The exact sequence is proprietary.Sequence: MAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTV KEEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTV SVTELQTHPELDTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDK YRSEALPT
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C or -80 degrees C. Avoid freeze / thaw cycle.
Entrez gene: 5589
Alternative names: PRKCSH; protein kinase C substrate 80K-H; G19P1; glucosidase 2 subunit beta; hepatocystin; AGE-binding receptor 2; glucosidase II subunit beta; glucosidase II, beta subunit; protein kinase C substrate, 80 Kda protein; protein kinase C substrate 60.1 kDa protein heavy chain; PCLD; PLD1; PKCSH; AGE-R2;
Additional info: Regulatory subunit of glucosidase II.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave