Qiagen
Home  >  Products  >  Anti-PPP2R2C (full length) polyclonal antibody

Anti-PPP2R2C (full length) polyclonal antibody

Cat no: DPABH-09567


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09567
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5522
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human PPP2R2C aa 1-430. Isoform 3 (AAH32954.1)Sequence: MGKRDTADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEY DVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKL WKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5522
Alternative names: PPP2R2C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform; protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform; IMYPNO; MGC33570; PP2A subunit B isoform gamma; PR52; PR55G; PP2A, subunit B, B-gamma isoform; PP2A, subunit B, R2-gamma isoform; PP2A, subunit B, B55-gamma isoform; PP2A, subunit B, PR55-gamma isoform; protein phosphatase 2A1 B gamma subunit; phosphoprotein phosphatase 2A BR gamma regulatory chain; gamma isoform of regulatory subunit B55, protein phosphatase 2; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform; serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform; IMYPNO1; B55-GAMMA;
Additional info: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave