Qiagen
Home  >  Products  >  Anti-PIAS1 (full length) polyclonal antibody

Anti-PIAS1 (full length) polyclonal antibody

Cat no: DPABH-09607


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09607
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 8554
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PIAS1 aa 1-651.Sequence: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS PAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYD GHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDEL IKPTSLASDNSQRFRETCFAFALTPQQVQQISSS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8554
Alternative names: PIAS1; protein inhibitor of activated STAT, 1; DDXBP1, DEAD/H (Asp Glu Ala Asp/His) box binding protein 1; E3 SUMO-protein ligase PIAS1; GBP; GU/RH II; zinc finger; MIZ type containing 3; ZMIZ3; gu-binding protein; AR interacting protein; DEAD/H box-binding protein 1; RNA helicase II-binding protein; zinc finger, MIZ-type containing 3; protein inhibitor of activated STAT-1; protein inhibitor of activated STAT protein 1; DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1; DDXBP1; GU/RH-II; MGC141878; MGC141879;
Additional info: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. In vitro, binds A/T-rich DNA. The effects of this transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context. Together with PRMT1, may repress STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave