Qiagen
Home  >  Products  >  Anti-METTL7A (full length) polyclonal antibody

Anti-METTL7A (full length) polyclonal antibody

Cat no: DPABH-09868


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09868
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 25840
Form: Liquid
Antigen: Full length protein corresponding to Human METTL7A aa 1-244. (NP_054752)Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQ MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN PNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSV KNQERILREVCRVLRPGGAF
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 25840
Alternative names: METTL7A; methyltransferase like 7A; methyltransferase-like protein 7A; DKFZP586A0522; protein AAM-B; AAM-B; DKFZp586A0522;
Additional info: Probable methyltransferase.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave