Qiagen
Home  >  Products  >  Anti-KCNE1 (full length) polyclonal antibody

Anti-KCNE1 (full length) polyclonal antibody

Cat no: DPABH-09488


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09488
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3753
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human KCNE1 aa 1-129.Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMV LGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL ESYRSCYVVENHLAIEQPNTHLPETKPSP Database link: P15382 Run BLAST with Run BLAST with
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3753
Alternative names: KCNE1; potassium voltage-gated channel, Isk-related family, member 1; potassium voltage-gated channel subfamily E member 1; ISK; JLNS2; minK; minimal potassium channel; delayed rectifier potassium channel subunit IsK; voltage gated potassiun channel accessory subunit; cardiac delayed rectifier potassium channel protein; potassium voltage-gated channel, Isk-related subfamily, member 1; IKs producing slow voltage-gated potassium channel subunit beta Mink; JLNS; LQT5; MinK; LQT2/5; FLJ18426; FLJ38123; FLJ94103; MGC33114;
Additional info: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave