Qiagen
Home  >  Products  >  Anti-ITPKB (full length) polyclonal antibody

Anti-ITPKB (full length) polyclonal antibody

Cat no: DPABH-09465


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09465
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3707
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human ITPKB aa 1-644. Isoform 2Sequence: MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSP GRGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSP SWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQNVQVNQKVGMF EAHIQAQSSAIQ
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3707
Alternative names: ITPKB; inositol-trisphosphate 3-kinase B; inositol 1,4,5 trisphosphate 3 kinase B; IP3 3KB; IP3KB; IP3K B; IP3 3-kinase B; insP 3-kinase B; proliferation-inducing protein 37; inositol 1,4,5-trisphosphate 3-kinase B; IP3K; PIG37; IP3K-B; IP3-3KB;
Additional info: ITPKB (inositol-trisphosphate 3-kinase B) is a protein-coding gene. Diseases associated with ITPKB include alzheimer's disease, and among its related super-pathways are Phosphatidylinositol signaling system and Metabolic pathways. GO annotations related to this gene include inositol-1,4,5-trisphosphate 3-kinase activity and calmodulin binding. An important paralog of this gene is ITPKC.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave