Qiagen
Home  >  Products  >  Anti-IL32 (full length) polyclonal antibody

Anti-IL32 (full length) polyclonal antibody

Cat no: DPABH-09765


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09765
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9235
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human IL32 aa 1-188. (NP_001012649).Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDF KEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEP GESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQS FCCSLSELFMSSFQSYGAP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9235
Alternative names: IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma;
Additional info: Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave