Qiagen
Home  >  Products  >  Anti-IFNA5 (full length) polyclonal antibody

Anti-IFNA5 (full length) polyclonal antibody

Cat no: DPABH-09441


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09441
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 3442
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human IFNA5 aa 1-189. (NP_002160.1)Sequence: MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPF SCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATW DETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRI TLYLTEKKYSPCAWEVVRAE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3442
Alternative names: IFNA5; interferon, alpha 5; interferon alpha-5; IFN alphaG; leIF G; IFN-alpha-5; interferon alpha-G; interferon alpha-61; INFA5; IFN-alphaG;
Additional info: IFNA5 (interferon, alpha 5) is a protein-coding gene. Diseases associated with IFNA5 include dengue hemorrhagic fever, and hemorrhagic fever, and among its related super-pathways are Toll-like receptor signaling pathway and Immune response IFN alpha/beta signaling pathway. GO annotations related to this gene include cytokine receptor binding and cytokine activity. An important paralog of this gene is IFNA7.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave