Qiagen
Home  >  Products  >  Anti-HOXB5 (full length) polyclonal antibody

Anti-HOXB5 (full length) polyclonal antibody

Cat no: DPABH-09448


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09448
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 3215
Form: Liquid
Antigen: Full length protein corresponding to Human HOXB5 aa 1-269.Sequence: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN GMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESL PCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEEAASQLS SPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLH
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3215
Alternative names: HOXB5; homeobox B5; homeo box B5; HOX2, HOX2A; homeobox protein Hox-B5; homeo box 2A; homeo box B5; homeobox protein Hu-1; homeobox protein Hox-2A; homeobox protein HHO.C10; HOX2; HU-1; HOX2A; Hox2.1; HHO.C10;
Additional info: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave