Qiagen
Home  >  Products  >  Anti-GPLD1 (full length) polyclonal antibody

Anti-GPLD1 (full length) polyclonal antibody

Cat no: DPABH-09468


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09468
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 2822
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human GPLD1 aa 1-176. Isoform 2Sequence: MSAFRLWPGLLIMLGSLCHRGSPCGLSTHIEIGHRALEFLQLHNGRVNYR ELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYI RENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDF HGSYSEAHSAGD
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 2822
Alternative names: GPLD1; glycosylphosphatidylinositol specific phospholipase D1; phosphatidylinositol-glycan-specific phospholipase D; GPI-PLD; PI-G PLD; GPI-specific phospholipase D; glycoprotein phospholipase D; phospholipase D, phosphatidylinositol-glycan-specific; glycosylphosphatidylinositol specific phospholipase D1, isoform 2; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1; MGC22590;
Additional info: This protein hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave