Qiagen
Home  >  Products  >  Anti-GNPAT (full length) polyclonal antibody

Anti-GNPAT (full length) polyclonal antibody

Cat no: DPABH-09684


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09684
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 8443
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human GNPAT aa 1-680.Sequence: MESSSSSNSYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSDLKF AMKCYTPLVYKGITPCKPIDIKCSVLNSEEIHYVIKQLSKESLQSVDVLR EEVSEILDEMSHKLRLGAIRFCAFTLSKVFKQIFSKVCVNEEGIQKLQRA IQEHPVVLLPSHRSYIDFLMLS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8443
Alternative names: GNPAT; glyceronephosphate O-acyltransferase; dihydroxyacetone phosphate acyltransferase; DAP AT; DAPAT; DHAPAT; DHAP-AT; glycerone-phosphate O-acyltransferase; acyl-CoA:dihydroxyacetonephosphateacyltransferase; DAP-AT;
Additional info: GNPAT (glyceronephosphate O-acyltransferase) is a protein-coding gene. Diseases associated with GNPAT include rhizomelic chondrodysplasia punctata type 2, and rhizomelic chondrodysplasia punctata, and among its related super-pathways are Glycerophospholipid biosynthesis and Metabolic pathways. GO annotations related to this gene include glycerol-3-phosphate O-acyltransferase activity and receptor binding. An important paralog of this gene is GPAM.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave