Qiagen
Home  >  Products  >  Anti-FOXH1 (full length) polyclonal antibody

Anti-FOXH1 (full length) polyclonal antibody

Cat no: DPABH-09739


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09739
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 8928
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human FOXH1 aa 1-365. (AAI11605.1).Sequence: MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP SRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAK PQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLH GRPYRPPSPPPPPSEGFSIK
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8928
Alternative names: FOXH1; forkhead box H1; forkhead box protein H1; FAST1; fast-2; hFAST-1; TGF-beta/activin signal transducer; forkhead activin signal transducer 2; forkhead activin signal transducer-1; FAST-1;
Additional info: Transcriptional activator. Recognizes and binds to the DNA sequence 5-TGT[GT][GT]ATT-3. Required for induction of the goosecoid (GSC) promoter by TGF-beta or activin signaling. Forms a transcriptionally active complex containing FOXH1/SMAD2/SMAD4 on a site on the GSC promoter called TARE (TGF-beta/activin response element).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave