Qiagen
Home  >  Products  >  Anti-E2F4 (full length) polyclonal antibody

Anti-E2F4 (full length) polyclonal antibody

Cat no: DPABH-09357


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09357
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 1874
Form: Liquid
Antigen: Recombinant full length protein corresponding to Human E2F4 aa 1-413. NCBI: NP_001941.2Sequence: MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTL AVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIEL KAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHEDICRCFA GDTLL
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped on Dry Ice. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 1874
Alternative names: E2F4; E2F transcription factor 4, p107/p130-binding; transcription factor E2F4; E2F 4; p107/p130-binding protein; E2F-4;
Additional info: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5-TTTC[CG]CGC-3 found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F-4 binds with high affinity to RBL1 and RBL2. In some instances, can also bind RB protein.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave