Qiagen
Home  >  Products  >  Anti-DUSP6 (full length) polyclonal antibody

Anti-DUSP6 (full length) polyclonal antibody

Cat no: DPABH-09416


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09416
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 1848
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human DUSP6 aa 1-381. (NP_001937).Sequence: MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHI ESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDE SSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETN LDGSCSSSSPPLPVLGLGGLR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 1848
Alternative names: DUSP6; dual specificity phosphatase 6; dual specificity protein phosphatase 6; MKP 3; PYST1; MAP kinase phosphatase 3; dual specificity protein phosphatase PYST1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 3; MKP3;
Additional info: Inactivates MAP kinases. Has a specificity for the ERK family.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave