Qiagen
Home  >  Products  >  Anti-DKKL1 (full length) polyclonal antibody

Anti-DKKL1 (full length) polyclonal antibody

Cat no: DPABH-09832


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09832
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 27120
Form: Liquid
Antigen: Full length protein corresponding to Human DKKL1 aa 1-242. (NP_055234.1).Sequence: MGEASPPAPARRHLLVLLLLLSTLVIPSAAAPIHDADAQESSLGLTGLQS LLQGFSRLFLKGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTL SSHLQIDKMTDNKTGEVLISENVVASIQPAEGSFEGDLKVPRMEEKEALV PIQKATDSFHTELHPRVAF
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 27120
Alternative names: DKKL1; dickkopf-like 1; dickkopf like 1 (soggy); dickkopf-like protein 1; cancer/testis antigen 34; CT34; SGY 1; soggy; soggy-1; protein soggy-1; SGY; SGY1; SGY-1;
Additional info: DKKL1 (dickkopf-like 1) is a protein-coding gene. Diseases associated with DKKL1 include multiple sclerosis, and among its related super-pathways are Non-Canonical Wnt Pathway. GO annotations related to this gene include signal transducer activity.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave