Qiagen
Home  >  Products  >  Anti-CCDC6 (full length) polyclonal antibody

Anti-CCDC6 (full length) polyclonal antibody

Cat no: DPABH-09662


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09662
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 8030
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human CCDC6 aa 1-474. (AAH64391.1)Sequence: MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIV ISPFRLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVT IQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLM QLQHEKAEL
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8030
Alternative names: CCDC6; coiled-coil domain containing 6; D10S170, DNA segment on chromosome 10 (unique) 170; TST1; coiled-coil domain-containing protein 6; DNA segment; single copy; probe pH4 (transforming sequence; thyroid 1; H4; PTC; TPC; papillary thyroid carcinoma-encoded protein; TST1; D10S170; FLJ32286;
Additional info: CCDC6 (coiled-coil domain containing 6) is a protein-coding gene. Diseases associated with CCDC6 include papillary thyroid carcinoma, and papillary carcinoma. GO annotations related to this gene include SH3 domain binding and structural constituent of cytoskeleton.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave