Qiagen
Home  >  Products  >  Anti-AP4M1 (full length) polyclonal antibody

Anti-AP4M1 (full length) polyclonal antibody

Cat no: DPABH-09668


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09668
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9179
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human AP4M1 aa 1-453. (NP_004713.2).Sequence: MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMH HHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEG TISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLS SVGLFGA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9179
Alternative names: AP4M1; adaptor-related protein complex 4, mu 1 subunit; AP-4 complex subunit mu-1; adaptor related protein complex AP 4 mu4 subunit; AP 4 adapter complex mu subunit; mu subunit of AP 4; MU 4; mu adaptin related protein 2; MU ARP2; mu4; mu4-adaptin; mu subunit of AP-4; mu-adaptin-related protein 2; mu-adaptin-related protein-2; adapter-related protein complex 4 mu-1 subunit; adaptor-related protein complex AP-4 mu4 subunit; MU-4; CPSQ3; MU-ARP2;
Additional info: Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave