Qiagen
Home  >  Products  >  Anti-AKAP7 (full length) polyclonal antibody

Anti-AKAP7 (full length) polyclonal antibody

Cat no: DPABH-09786


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09786
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 9465
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human AKAP7 aa 1-104. Isoform Beta (NP_619539.1)Sequence: MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA ELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNE NNRK Database link: O43687
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9465
Alternative names: AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; AKAP 18; PRKA7 isoform gamma; AKAP-7 isoform gamma; PRKA7 isoforms alpha/beta; A-kinase anchor protein 9 kDa; A-kinase anchor protein 18 kDa; AKAP-7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms alpha and beta;
Additional info: Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave