Qiagen
Home  >  Products  >  Anti-ACSBG1 (full length) polyclonal antibody

Anti-ACSBG1 (full length) polyclonal antibody

Cat no: DPABH-09827


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09827
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 23205
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human ACSBG1 aa 1-724.Sequence: MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQ PLSKESLNHALELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQ LPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYLLARRAAKGFL KLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 23205
Alternative names: ACSBG1; acyl-CoA synthetase bubblegum family member 1; long-chain-fatty-acid--CoA ligase ACSBG1; BG1; BGM; bubblegum; FLJ30320; hBG1; hsBG; KIAA0631; lipidosin; MGC14352; very long chain acyl CoA synthetase; very long-chain acyl-CoA synthetase; BG; LPD; GR-LACS;
Additional info: Mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. Can activate diverse saturated, monosaturated and polyunsaturated fatty acids.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave