Quick Search
Products Prostaglandin I Synthase Polyclonal Antibody
| Catalogue number: | 160640 |
| Hosts: | Rabbit |
| Applications: | Immunoprecipitation, Western Blot |
| Weight: | 0 |
| Form: | 1 ea |
| Antigen: | bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT){3477,3476,3478} |
| P type: | Antibodies|Eicosanoids |
| Shipping temp: | -20 |
| Storage temp: | -20 |
| Additional info: | Prostaglandin I synthase (PGIS) catalyzes the isomerization of PGH2 to PGI2. PGI2 (prostacyclin) is a potent vasodilator and inhibitor of platelet aggregation. PGIS is a membrane-bound hemoprotein localized primarily in endothelial cells. The cloned bovine and human enzymes contain 500 amino acids and a calculated molecular mass of 56,629 and 57,103, respectively. Northern blot analysis reveals that the mRNA for PGIS is expressed in a wide variety of human tissues and is particularly abundant in ovary, heart, skeletal muscle, lung, and prostate. |
Get the Best Promotions
