Quick Search
Products Kv1.2 potassium channel
| Catalogue number: | 73-314, 75-314 |
| Reactivities: | Human, Mouse, Rat |
| Hosts: | Mouse |
| Applications: | Immunocytochemistry, Immunohistochemistry |
| Conjugates: | Unconjugated |
| Size: | 5 mL (TC supernatant), 100ul (pure) |
| Clone: | L76/36 |
| Accession: | P16389 |
| Antigen: | Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (epitope mapped to within amino acids 463-480) |
| Format: | TC Supe, Pure |
| P type: | Monoclonal |
| Target: | Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2 |
| Species: | Human |
| Isotype: | IgG2a |
Get the Best Promotions
