Home  >  Products  >  EP4 Receptor (C-Term) Blocking Peptide
EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Cat no: 301775

Supplier: Cayman Chemical Company
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI){3164,3186} . To be used in conjunction with Cayman's EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
Catalogue number: 301775
Weight: 0
Form: 1 ea
P type: Antibodies
Shipping temp: -20
Storage temp: -20
Additional info: To be used in conjunction with Cayman's EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Cayman Chemical Company
Get a Quote Direct from
Cayman Chemical Company

By submitting this form you agree to your details being passed to Cayman Chemical Company for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave