Home  >  Products  >  anti-Cadherin 1, Type 1, E-Cadherin (Epithelial) (CDH1) (Middle Region) antibody
anti-Cadherin 1, Type 1, E-Cadherin (Epithelial) (CDH1) (Middle Region) antibody

anti-Cadherin 1, Type 1, E-Cadherin (Epithelial) (CDH1) (Middle Region) antibody

Cat no: ABIN503222

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Cadherin 1, Type 1, E-Cadherin (Epithelial) (CDH1) (Middle Region) antibody: This is a rabbit polyclonal antibody against CDH1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503222
Reactivities: Human, Mouse, Rat, Bovine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 999,100048953,282637,12550,83502
Concentration: 1 mg/mL
Antigen: CDH1
Clonality: Polyclonal
Sequence: QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAI STRAELDRED
Molecular weight: 80 kDa
Entrez gene: 999,100048953,282637,12550,83502

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave