Qiagen
Home  >  Products  >  Rabbit anti-Human HERC3 polyclonal antibody

Rabbit anti-Human HERC3 polyclonal antibody

Cat no: DPABH-09726


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09726
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 8916
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human HERC3 aa 1-1050.Sequence: MLCWGYWSLGQPGISTNLQGIVAEPQVCGFISDRSVKEVACGGNHSVFLL EDGEVYTCGLNTKGQLGHEREGNKPEQIGALADQHIIHVACGESHSLALS DRGQLFSWGAGSDGQLGLMTTEDSVAVPRLIQKLNQQTILQVSCGNWHCL ALAADGQFFTWGKNSHGQLGLGKEFPSQASPQR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8916
Alternative names: HERC3; HECT and RLD domain containing E3 ubiquitin protein ligase 3; hect domain and RLD 3; probable E3 ubiquitin-protein ligase HERC3; KIAA0032; HECT domain and RCC1-like domain-containing protein 3;
Additional info: HERC3 (Hect domain and RLD 3) belongs to the HERC family of ubiquitin ligases which contain a HECT domain and at least 1 RCC1-like domain (RLD). E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. The RLD domain is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave