Qiagen
Home  >  Products  >  Mouse anti-Human CYP26A1 polyclonal antibody

Mouse anti-Human CYP26A1 polyclonal antibody

Cat no: DPABH-09409


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09409
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 1592
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human CYP26A1 aa 1-428.Sequence: MKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTI LGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLS CGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTR NLFSLPIDVPFSGLYRGMKA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 1592
Alternative names: CYP26A1; cytochrome P450, family 26, subfamily A, polypeptide 1; cytochrome P450, subfamily XXVIA, polypeptide 1; cytochrome P450 26A1; CP26; CYP26; P450RAI; P450RAI1; hP450RAI; cytochrome P450RAI; retinoic acid 4-hydroxylase; P450, retinoic acid-inactivating, 1; retinoic acid-metabolizing cytochrome; cytochrome P450 retinoic acid-inactivating 1;
Additional info: Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18-hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave