Qiagen
Home  >  Products  >  Anti-XRCC2 (full length) polyclonal antibody

Anti-XRCC2 (full length) polyclonal antibody

Cat no: DPABH-09541


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09541
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 7516
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human XRCC2 aa 1-280. (NP_005422).Sequence: MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPE GTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRL SQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDS LSAFYWIDR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7516
Alternative names: XRCC2; X-ray repair complementing defective repair in Chinese hamster cells 2; DNA repair protein XRCC2; RAD51 like; X-ray repair cross-complementing protein 2; X-ray repair, complementing defective, repair in Chinese hamster; DKFZp781P0919;
Additional info: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave