Qiagen
Home  >  Products  >  Anti-VIPR1 (full length) polyclonal antibody

Anti-VIPR1 (full length) polyclonal antibody

Cat no: DPABH-09690


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09690
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 7433
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human VIPR1 aa 1-457.Sequence: MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQC LEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRN VSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY GLSLATLLVATAILSLFRKLHC
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7433
Alternative names: VIPR1; vasoactive intestinal peptide receptor 1; vasoactive intestinal polypeptide receptor 1; HVR1; RDC1; VIP and PACAP receptor 1; VPAC1; VPAC1R; VIP receptor, type I; PACAP type II receptor; pituitary adenylate cyclase activating polypeptide receptor, type II; II; V1RG; VIPR; VIRG; VAPC1; VIP-R-1; VPCAP1R; PACAP-R2; PACAP-R-2; FLJ41949;
Additional info: VIPR1 (vasoactive intestinal peptide receptor 1) is a protein-coding gene. Diseases associated with VIPR1 include scimitar syndrome, and idiopathic achalasia, and among its related super-pathways are Signaling by GPCR and Class A/1 (Rhodopsin-like receptors). GO annotations related to this gene include vasoactive intestinal polypeptide receptor activity. An important paralog of this gene is GLP1R.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave