Qiagen
Home  >  Products  >  Anti-VAX2 (full length) polyclonal antibody

Anti-VAX2 (full length) polyclonal antibody

Cat no: DPABH-09853


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09853
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 25806
Form: Liquid
Antigen: Full length protein corresponding to Human VAX2 aa 1-290.Sequence: MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTS ASSPAGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLD RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWF QNRRTKQKKDQSRDLEKRASSSASEAFATSNILRL
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 25806
Alternative names: VAX2; ventral anterior homeobox 2; DRES93;
Additional info: VAX2 belongs to the EMX homeobox family and contains 1 homeobox DNA-binding domain. VAX2 gene has high sequence similarity to VAX1 gene and is almost exclusively expressed in the ventral portion of the retina during development. It may play an important role in morphogenetic processes underlying the correct development of the eye, particularly in the establishment of a correct dorsoventral pattern and may be a regulator of axial polarization in the retina.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave