Qiagen
Home  >  Products  >  Anti-UCP2 (full length) polyclonal antibody

Anti-UCP2 (full length) polyclonal antibody

Cat no: DPABH-09620


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09620
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 7351
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human UCP2 aa 1-309.Sequence: MVGFKATDVPPTATVKFLGAGTAACIADLITFPLGTAKVRLQIQGESQGP VRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLY DSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARA GGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVAR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7351
Alternative names: UCP2; uncoupling protein 2 (mitochondrial, proton carrier); mitochondrial uncoupling protein 2; SLC25A8; UCP 2; solute carrier family 25 member 8; UCPH; BMIQ4;
Additional info: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave