Qiagen
Home  >  Products  >  Anti-TSSK2 (full length) polyclonal antibody

Anti-TSSK2 (full length) polyclonal antibody

Cat no: DPABH-09849


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09849
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 25785
Form: Liquid
Antigen: Full length protein corresponding to Human TSSK2 aa 1-358.Sequence: MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPT DFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLE FIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNI KLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 25785
Alternative names: TSSK2; testis specific serine threonine kinase 2; DGS-G;
Additional info: Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at Ser-288 and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave