Qiagen
Home  >  Products  >  Anti-TPD52L1 (full length) polyclonal antibody

Anti-TPD52L1 (full length) polyclonal antibody

Cat no: DPABH-09682


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09682
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 7164
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human TPD52L1 aa 1-204.Sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEI TTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTH ETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSF EERVETTVTSLKTKVGGTNP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7164
Alternative names: TPD52L1; tumor protein D52-like 1; tumor protein D53; D53; hD53; MGC8556;
Additional info: TPD52L1 (tumor protein D52-like 1) is a protein-coding gene. Diseases associated with TPD52L1 include collecting duct carcinoma, and childhood leukemia, and among its related super-pathways are Golgi Associated Vesicle Biogenesis and Translocation of GLUT4 to the Plasma Membrane. GO annotations related to this gene include protein homodimerization activity and identical protein binding. An important paralog of this gene is TPD52L3.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave