Qiagen
Home  >  Products  >  Anti-TMEFF2 (full length) polyclonal antibody

Anti-TMEFF2 (full length) polyclonal antibody

Cat no: DPABH-09860


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09860
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 23671
Form: Liquid
Antigen: Full length protein corresponding to Human TMEFF2 aa 1-374. (NP_057276)Sequence: MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQT PTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYV PVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEG SGETSQKETSTCDICQFGAEC
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 23671
Alternative names: TMEFF2; transmembrane protein with EGF-like and two follistatin-like domains 2; tomoregulin-2; cancer/testis antigen family 120; member 2; CT120.2; HPP1; TENB2; tomoregulin; TPEF; TR; transmembrane protein TENB2; TR-2; hyperplastic polyposis protein 1; cancer/testis antigen family 120, member 2;
Additional info: May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave