Qiagen
Home  >  Products  >  Anti-TKTL1 (full length) polyclonal antibody

Anti-TKTL1 (full length) polyclonal antibody

Cat no: DPABH-09611


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09611
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 8277
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human TKTL1 aa 1-540.Sequence: MSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGM AYTGKYFDRASYRVFCLMSDGESSEGSVWEAMAFASYYSLDNLVATFDVN RLGHSGALPAEHCINIYQRRCEAFGWNTYVVDGRDVEALCQVFWQASQVK HKPTAVVAKTFKGRGTPSIEDAESWHAKPMPRER
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8277
Alternative names: TKTL1; transketolase-like 1; transketolase-like protein 1; TKR; TKT2; TK 2; transketolase-2; transketolase-related protein;
Additional info: TKTL1 (transketolase-like 1) is a protein-coding gene. Diseases associated with TKTL1 include wernicke-korsakoff syndrome, and hypochondroplasia, and among its related super-pathways are pentose phosphate pathway and Biosynthesis of amino acids. GO annotations related to this gene include metal ion binding and transketolase activity. An important paralog of this gene is TKTL2.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave