Qiagen
Home  >  Products  >  Anti-TIMP4 (full length) polyclonal antibody

Anti-TIMP4 (full length) polyclonal antibody

Cat no: DPABH-09661


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09661
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 7079
Form: Liquid
Antigen: Recombinant full length protein corresponding to Human TIMP4 aa 1-224.Sequence: MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRA KISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSS LCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNH HYHLNCGCQITTCYTVPCTISA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7079
Alternative names: TIMP4; TIMP metallopeptidase inhibitor 4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; TIMP-4; tissue inhibitor of metalloproteinases 4;
Additional info: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave