Qiagen
Home  >  Products  >  Anti-TAL1 (full length) polyclonal antibody

Anti-TAL1 (full length) polyclonal antibody

Cat no: DPABH-09629


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09629
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 6886
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human Tal1 aa 1-331. (AAI60033.1).Sequence: MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPP VIELGARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPA PAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSG FFGEPDAFPMFTTNNRVKRRP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6886
Alternative names: TAL1; T-cell acute lymphocytic leukemia 1; TCL5; T-cell acute lymphocytic leukemia protein 1; bHLHa17; SCL; tal-1 product; stem cell protein; T-cell leukemia/lymphoma protein 5; class A basic helix-loop-helix protein 17; tal-1;
Additional info: Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave