Qiagen
Home  >  Products  >  Anti-TAF13 (full length) polyclonal antibody

Anti-TAF13 (full length) polyclonal antibody

Cat no: DPABH-09646


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09646
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 6884
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 99% PBS
Antigen: Full length protein corresponding to Human TAF13 aa 1-124.Sequence: MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPY TESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARV KDLLTMNEELKRARKAFDEANYGSDatabase link: NP_005636.1
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6884
Alternative names: TAF13; TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa; TAF2K, TATA box binding protein (TBP) associated factor, RNA polymerase II, K, 18kD; transcription initiation factor TFIID subunit 13; TAFII18; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD; TAF2K; TAFII-18; TAF(II)18; MGC22425;
Additional info: TFIID beta-specific TAFII.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave