Qiagen
Home  >  Products  >  Anti-TAB2 (full length) polyclonal antibody

Anti-TAB2 (full length) polyclonal antibody

Cat no: DPABH-09829


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09829
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 23118
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human TAB2 aa 1-693.Sequence: MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQES TRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGS RTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASN SAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 23118
Alternative names: TAB2; TGF-beta activated kinase 1/MAP3K7 binding protein 2; MAP3K7IP2, mitogen activated protein kinase kinase kinase 7 interacting protein 2; TGF-beta-activated kinase 1 and MAP3K7-binding protein 2; KIAA0733; TAB-2; TAK1-binding protein 2; TGF-beta-activated kinase 1-binding protein 2; mitogen-activated protein kinase kinase kinase 7-interacting protein 2; CHTD2; MAP3K7IP2; FLJ21885;
Additional info: Adapter linking MAP3K7/TAK1 and TRAF6. Promotes MAP3K7 activation in the IL1 signaling pathway. The binding of Lys-63-linked polyubiquitin chains to TAB2 promotes autophosphorylation of MAP3K7 at Thr-187. Involved in heart development.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave