Qiagen
Home  >  Products  >  Anti-STK25 (full length) polyclonal antibody

Anti-STK25 (full length) polyclonal antibody

Cat no: DPABH-09808


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09808
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 10494
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human STK25 aa 1-426.Sequence: MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKI IDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGG GSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSE QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 10494
Alternative names: STK25; serine/threonine kinase 25; serine/threonine kinase 25 (Ste20, yeast homolog); serine/threonine-protein kinase 25; SOK1; YSK1; SOK-1; ste20-like kinase; Ste20, yeast homolog; ste20/oxidant stress response kinase 1; sterile 20/oxidant stress-response kinase 1; serine/threonine kinase 25 (STE20 homolog, yeast); sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1); DKFZp686J1430;
Additional info: Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave