Qiagen
Home  >  Products  >  Anti-SND1 (full length) polyclonal antibody

Anti-SND1 (full length) polyclonal antibody

Cat no: DPABH-09852


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09852
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 27044
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human SND1 aa 1-910.Sequence: MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQIN LSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIE NKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLS ECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRH
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 27044
Alternative names: SND1; staphylococcal nuclease and tudor domain containing 1; staphylococcal nuclease domain-containing protein 1; p100; p100 EBNA2 co activator; TDRD11; p100 co-activator; 100 kDa coactivator; EBNA2 coactivator p100; p100 EBNA2 co-activator; EBNA-2 co-activator (100kD); tudor domain-containing protein 11; staphylococcal nuclease domain containing 1;
Additional info: Functions as a bridging factor between STAT6 and the basal transcription factor. Plays a role in PIM1 regulation of MYB activity. Functions as a transcriptional coactivator for the Epstein-Barr virus nuclear antigen 2 (EBNA2).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave