Qiagen
Home  >  Products  >  Anti-SNAP29 (full length) polyclonal antibody

Anti-SNAP29 (full length) polyclonal antibody

Cat no: DPABH-09767


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09767
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 9342
Form: Liquid
Antigen: Full length protein corresponding to Human SNAP29 aa 1-258. (NP_004773.1).Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVL RRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQ DLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAI STSKEQEAKYQASHPNLR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9342
Alternative names: SNAP29; synaptosomal-associated protein, 29kDa; synaptosomal associated protein, 29kD; synaptosomal-associated protein 29; CEDNIK; SNAP 29; soluble 29 kDa NSF attachment protein; vesicle-membrane fusion protein SNAP-29; SNAP-29; FLJ21051;
Additional info: Involved in multiple membrane trafficking steps.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave