Qiagen
Home  >  Products  >  Anti-SLC3A1 (full length) polyclonal antibody

Anti-SLC3A1 (full length) polyclonal antibody

Cat no: DPABH-09604


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09604
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 6519
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human SLC3A1 aa 1-685.Sequence: MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRG ILGSQEPDFKGVQPYAGMPKEVLFQFSGQARYRIPREILFWLTVASVLVL IAATIAIIALSPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLD YITALNIKTVWITSFYKSSLKDFRYGVEDFREV
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6519
Alternative names: SLC3A1; solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1; neutral and basic amino acid transport protein rBAT; ATR1; CSNU1; D2H; NBAT; RBAT; SLC3A1 variant B; SLC3A1 variant C; SLC3A1 variant D; SLC3A1 variant E; SLC3A1 variant F; SLC3A1 variant G; amino acid transporter 1; B(0,+)-type amino acid transport protein; solute carrier family 3 (cystine, dibasic and neutral amino acid transporters), member 1; FLJ34681;
Additional info: Involved in the high-affinity, sodium-independent transport of cystine and neutral and dibasic amino acids (system B(0,+)-like activity). May function as an activator of SLC7A9 and be involved in the high-affinity reabsorption of cystine in the kidney tubule.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave